PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A01168.1.p
Common NameEUGRSUZ_A01168, LOC104435758
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family S1Fa-like
Protein Properties Length: 85aa    MW: 9120.84 Da    PI: 10.19
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A01168.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA132.41.2e-411984570
              S1FA  5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                      +++a G+nPGlivll+v+glll+flvgny+lyvyaqk+lPP+kkkPvskkk+kreklkqGv++PGe
  Eucgr.A01168.1.p 19 AADAGGFNPGLIVLLLVAGLLLIFLVGNYVLYVYAQKTLPPKKKKPVSKKKMKREKLKQGVSAPGE 84
                      56889************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046893.2E-392184IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MAEDFEFADQ VPPSFDGKAA DAGGFNPGLI VLLLVAGLLL IFLVGNYVLY VYAQKTLPPK  60
KKKPVSKKKM KREKLKQGVS APGE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A01168.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010046757.12e-53PREDICTED: DNA-binding protein S1FA-like
SwissprotQ7XLX67e-16S1FA2_ORYSJ; DNA-binding protein S1FA2
TrEMBLA0A059DF132e-53A0A059DF13_EUCGR; Uncharacterized protein
STRINGPOPTR_0016s08890.18e-23(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769